Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.30
PubTator Score 2.59

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
astrocytoma 1493 1.91970112700905E-15
oligodendroglioma 2849 4.37008992370711E-13
pilocytic astrocytoma 3086 7.25171378184818E-8
glioblastoma 5572 3.01130015552839E-7
pediatric high grade glioma 2712 1.14458945403045E-5
group 3 medulloblastoma 2254 3.41098462786719E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 2.13889538942866E-4
ependymoma 2514 2.9903546432276E-4
pancreatic cancer 2300 3.84838491921077E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00158979684346992
ulcerative colitis 2087 0.00175037348083454
cystic fibrosis 1670 0.00192621323110926
invasive ductal carcinoma 2950 0.00456790276387605
subependymal giant cell astrocytoma 2287 0.0192688236534825
head and neck cancer 270 0.0212057070503893
Disease Target Count Z-score Confidence
Essential Hypertension 82 0.0 2.0

Expression

  Differential Expression (15)

Synonym

Accession A6NI28 Q96M56
Symbols GRAF3

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Opossum OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (2)

PMID Text
24335996 The smooth muscle-selective GRAF3 is a critical regulator of vascular tone and hypertension.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKFSQSLQDFQFE      1 - 70
CIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFRKEQIGAAKDGKKKFDKESEK     71 - 140
YYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVEPLLSFLQGLFTF    141 - 210
YHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPL    211 - 280
GFTWIKHYCTYDKGSKTFTMSVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHG    281 - 350
IITLQAFSEANRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG    351 - 420
VNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIAVKSDDQNYRV    421 - 490
EAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQNIV    491 - 560
VEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTP    561 - 630
MGSIESLSSHSSEQNSTTKSASCQPREKSGGIPWIATPSSSNGQKSLGLWTTSPESSSREDATKTDAESD    631 - 700
CQSVASVTSPGDVSPPIDLVKKEPYGLSGLKRASASSLRSISAAEGNKSYSGSIQSLTSVGSKETPKASP    701 - 770
NPDLPPKMCRRLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKPVSSGRQAKAMYSCKAEHSHELSFPQG    771 - 840
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL                                        841 - 874
//

Text Mined References (11)

PMID Year Title
24335996 2013 The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18954304 2009 A BAR domain-mediated autoinhibitory mechanism for RhoGAPs of the GRAF family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...