Property Summary

NCBI Gene PubMed Count 8
PubMed Score 4.30
PubTator Score 2.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Gene RIF (2)

PMID Text
24335996 The smooth muscle-selective GRAF3 is a critical regulator of vascular tone and hypertension.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MGLPTLEFSDSYLDSPDFRERLQCHEIELERTNKFIKELIKDGSLLIGALRNLSMAVQKFSQSLQDFQFE      1 - 70
CIGDAETDDEISIAQSLKEFARLLIAVEEERRRLIQNANDVLIAPLEKFRKEQIGAAKDGKKKFDKESEK     71 - 140
YYSILEKHLNLSAKKKESHLQEADTQIDREHQNFYEASLEYVFKIQEVQEKKKFEFVEPLLSFLQGLFTF    141 - 210
YHEGYELAQEFAPYKQQLQFNLQNTRNNFESTRQEVERLMQRMKSANQDYRPPSQWTMEGYLYVQEKRPL    211 - 280
GFTWIKHYCTYDKGSKTFTMSVSEMKSSGKMNGLVTSSPEMFKLKSCIRRKTDSIDKRFCFDIEVVERHG    281 - 350
IITLQAFSEANRKLWLEAMDGKEPIYTLPAIISKKEEMYLNEAGFNFVRKCIQAVETRGITILGLYRIGG    351 - 420
VNSKVQKLMNTTFSPKSPPDIDIDIELWDNKTITSGLKNYLRCLAEPLMTYKLHKDFIIAVKSDDQNYRV    421 - 490
EAVHALVHKLPEKNREMLDILIKHLVKVSLHSQQNLMTVSNLGVIFGPTLMRAQEETVAAMMNIKFQNIV    491 - 560
VEILIEHYEKIFHTAPDPSIPLPQPQSRSGSRRTRAICLSTGSRKPRGRYTPCLAEPDSDSYSSSPDSTP    561 - 630
MGSIESLSSHSSEQNSTTKSASCQPREKSGGIPWIATPSSSNGQKSLGLWTTSPESSSREDATKTDAESD    631 - 700
CQSVASVTSPGDVSPPIDLVKKEPYGLSGLKRASASSLRSISAAEGNKSYSGSIQSLTSVGSKETPKASP    701 - 770
NPDLPPKMCRRLRLDTASSNGYQRPGSVVAAKAQLFENVGSPKPVSSGRQAKAMYSCKAEHSHELSFPQG    771 - 840
AIFSNVYPSVEPGWLKATYEGKTGLVPENYVVFL                                        841 - 874
//

Text Mined References (11)

PMID Year Title
24335996 2013 The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.
23667675 2013 Genome wide association study of age at menarche in the Japanese population.
21909115 2011 Genetic variants in novel pathways influence blood pressure and cardiovascular disease risk.
21909110 2011 Genome-wide association study identifies six new loci influencing pulse pressure and mean arterial pressure.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18954304 2009 A BAR domain-mediated autoinhibitory mechanism for RhoGAPs of the GRAF family.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...