Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NHZ5
Symbols

Gene

 Compartment GO Term (1)

AA Sequence

MDTMRSLRFISAEALVSHPQVARQSLDSVAHNLYPLLFKASYLLEQAEVTRAVLGRWPLEEFRLGALLGP      1 - 70
GADHPQDLRDRTCRACLEALVRGLADHVLQDRSRRRLRVADLTGIRDVQVQRCPCGRALGRWGRTQLLAR     71 - 140
TCCELQAEPLAAGRPVEVLADLFVTEGNFEAVVQALRPAGPAPLRVHCPSFRADSLSPSQLLHVLRLAGP    141 - 210
GALRKLEVVHNVRLHAGHVQQLLAQVGFPRLASLTLPTKAFDAPPTYASTPDGEDPLLASIARELSKMAQ    211 - 280
LTELSVAFSTLTGKIPTLLGPLQTPLRVLDLANCALNHTDMAFLADCAHAAHLEVLDLSGHNLVSLYPST    281 - 350
FFRLLSQASRTLRILTLEECGIVDSHVGMLILGLSPCHRLRQLKFLGNPLSARALRRLFTALCELPELRC    351 - 420
IEFPVPKDCYPEGAAYPQDELAMSKFNQQKYDEIAEELRAVLLRADREDIQVSTPLFGSFDPDIQETSNE    421 - 490
LGAFLLQAFKTALENFSRALKQIE                                                  491 - 514
//

Text Mined References (1)

PMID Year Title
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.