Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NHY6
Symbols bA342C23.1

Gene

 Compartment GO Term (1)

AA Sequence

MCYVVPGCFIYICGCTRIKSTHFNGKSQMVDLKSQSWDLERFENKPPPAVYDLAATTSQLGEWAKSRIW       1 - 69
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.