Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis -1.500 0.000
facioscapulohumeral dystrophy 2.100 0.001

Synonym

Accession A6NHY2
Symbols

Gene

 GO Process (1)

 Compartment GO Term (1)

Gene RIF (1)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MDPAGRARGQGATAGGLLLRAAAAAKGLREDLWGAAALPWRSLSRIPKREGLGEEDTAVAGHELLLPNER      1 - 70
SFQNAAKSNNLDLMEKLFEKKVNINVVNNMNRTALHFAVGRNHLSAVDFLLKHKARVDVADKHGLTVIHL     71 - 140
AAWSGSLEVMLMLVKAGADQRAKNQDGMSALHFATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAA    141 - 210
ERGHVEMIEKLTFLNLHTSEKDKGGNTALHLAAKHGHSPAVQVLLAQWQDINEMNELNISSLQIATRNGH    211 - 280
ASLVNFLLSENVDLHQKVEPKESPLHLVVINNHITVVNSLLSAQHDIDILNQKQQTPLHVAADRGNVELV    281 - 350
ETLLKAGCDLKAVDKQGKTALAVASRSNHSLVVGMLIKAERYYAWREEHHESIRDPSTGFTLTFKQDHSL    351 - 420
ETRHIRTLLWDLAYHQLKANEWQRLARSWNFTDDQIRAIEEQWSGNESFREHGHRALLIWLHGTLMTQGD    421 - 490
PAKQLYEELVHAGFPKLAEKTRHFKSKTDSNSKKCVVS                                    491 - 528
//

Text Mined References (2)

PMID Year Title
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.