Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.0e-27
facioscapulohumeral dystrophy 288 1.4e-03
Disease Target Count Z-score Confidence
Obesity 678 0.0 1.1

Expression

  Differential Expression (2)

Disease log2 FC p
facioscapulohumeral dystrophy 2.100 1.4e-03
psoriasis -1.500 1.0e-27

Gene RIF (1)

AA Sequence

MDPAGRARGQGATAGGLLLRAAAAAKGLREDLWGAAALPWRSLSRIPKREGLGEEDTAVAGHELLLPNER      1 - 70
SFQNAAKSNNLDLMEKLFEKKVNINVVNNMNRTALHFAVGRNHLSAVDFLLKHKARVDVADKHGLTVIHL     71 - 140
AAWSGSLEVMLMLVKAGADQRAKNQDGMSALHFATQSNHVRIVEYLIQDLHLKDLNQPDEKGRKPFLLAA    141 - 210
ERGHVEMIEKLTFLNLHTSEKDKGGNTALHLAAKHGHSPAVQVLLAQWQDINEMNELNISSLQIATRNGH    211 - 280
ASLVNFLLSENVDLHQKVEPKESPLHLVVINNHITVVNSLLSAQHDIDILNQKQQTPLHVAADRGNVELV    281 - 350
ETLLKAGCDLKAVDKQGKTALAVASRSNHSLVVGMLIKAERYYAWREEHHESIRDPSTGFTLTFKQDHSL    351 - 420
ETRHIRTLLWDLAYHQLKANEWQRLARSWNFTDDQIRAIEEQWSGNESFREHGHRALLIWLHGTLMTQGD    421 - 490
PAKQLYEELVHAGFPKLAEKTRHFKSKTDSNSKKCVVS                                    491 - 528
//

Text Mined References (2)

PMID Year Title