Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung carcinoma 2843 1.9e-25

Synonym

Accession A6NHX0 A6NNH0 B9EJH9
Symbols GATSL1
GATSL2

Gene

Gene RIF (1)

AA Sequence

MELHILEHRLQVASVAKESIPLFTYGLIKLAFLSSKTRCKFFSLTETPEDYTIIVDEEGFLELPSSEHLS      1 - 70
VADATWLALNVVSGGGSFSSSQPIGVTKIAKSVIAPLADQNISVFMLSTYQTDFILVRERDLPFVTHTLS     71 - 140
SEFTILRVVNGETVAAENLGITNGFVKPKLVQRPVIHPLSSPSNRFCVTSLDPDTLPAVATLLMDVMFYS    141 - 210
NGVKDPMATGDDCGHIRFFSFSLIEGYISLVMDVQTQQRFPSNLLFTSASGELWKMVRIGGQPLGFDECG    211 - 280
IVAQISEPLAAADIPAYYISTFKFDHALVPEENINGVISALKVSQAEKH                         281 - 329
//

Text Mined References (5)

PMID Year Title