Property Summary

NCBI Gene PubMed Count 4
PubMed Score 14.20
PubTator Score 4.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

Gene RIF (2)

AA Sequence

MPEPGPDAAGTASAQPQPPPPPPPAPKESPFSIKNLLNGDHHRPPPKPQPPPRTLFAPASAAAAAAAAAA      1 - 70
AAAKGALEGAAGFALSQVGDLAFPRFEIPAQRFALPAHYLERSPAWWYPYTLTPAGGHLPRPEASEKALL     71 - 140
RDSSPASGTDRDSPEPLLKADPDHKELDSKSPDEIILEESDSEESKKEGEAAPGAAGASVGAAAATPGAE    141 - 210
DWKKGAESPEKKPACRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRN    211 - 280
KWKRQLAAELEAANLSHAAAQRIVRVPILYHENSAAEGAAAAAAGAPVPVSQPLLTFPHPVYYSHPVVSS    281 - 350
VPLLRPV                                                                   351 - 357
//

Text Mined References (5)

PMID Year Title