Knowledge Summary

Patent

No data available

Synonym

Accession A6NHS1
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MVLLAGTRPQGGEARCMIPPPPSPLLGAQVEEDRTEFKEFQDFSSLPDTRSVASDDSLYPFQDEEEHGVE      1 - 70
GVESVPEEGILEAWGSCGRWCGVG                                                   71 - 94
//

Text Mined References (1)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.