Property Summary

NCBI Gene PubMed Count 30
PubMed Score 33.59
PubTator Score 32.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.7
Disease Target Count Z-score Confidence
Microphthalmia 76 3.116 1.6
Klinefelter's syndrome 56 0.0 4.0
Disease Target Count Z-score Confidence
Muscular dystrophy 75 5.495 2.7

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma 1.100 3.4e-02
astrocytic glioma 1.100 7.7e-03
atypical teratoid / rhabdoid tumor 1.800 8.8e-04
cutaneous lupus erythematosus 1.100 6.2e-03
ependymoma 1.100 3.2e-02
gastric cancer -1.700 2.3e-03
glioblastoma 1.600 2.2e-03
group 4 medulloblastoma 1.100 1.7e-03
intraductal papillary-mucinous neoplasm ... 1.100 1.3e-02
invasive ductal carcinoma 1.075 2.7e-02
malignant mesothelioma 1.100 4.4e-04
medulloblastoma, large-cell 1.700 2.7e-04
Multiple Sclerosis 1.100 4.0e-04
osteosarcoma 1.220 5.0e-03
ovarian cancer -1.200 4.6e-03
pancreatic cancer -1.600 8.4e-03
pancreatic carcinoma -1.600 8.4e-03
Pick disease -1.200 3.4e-04
pituitary cancer 1.100 7.2e-04
primary Sjogren syndrome 1.400 3.7e-04
primitive neuroectodermal tumor 1.500 3.0e-03
progressive supranuclear palsy -1.500 5.6e-03
psoriasis 1.100 1.1e-03
Rheumatoid arthritis 1.200 2.7e-02

Gene RIF (20)

AA Sequence

MAAADGGGPGGASVGTEEDGGGVGHRTVYLFDRREKESELGDRPLQVGERSDYAGFRACVCQTLGISPEE      1 - 70
KFVITTTSRKEITCDNFDETVKDGVTLYLLQSVNQLLLTATKERIDFLPHYDTLVKSGMYEYYASEGQNP     71 - 140
LPFALAELIDNSLSATSRNIGVRRIQIKLLFDETQGKPAVAVIDNGRGMTSKQLNNWAVYRLSKFTRQGD    141 - 210
FESDHSGYVRPVPVPRSLNSDISYFGVGGKQAVFFVGQSARMISKPADSQDVHELVLSKEDFEKKEKNKE    211 - 280
AIYSGYIRNRKPSDSVHITNDDERFLHHLIIEEKEKDSFTAVVITGVQPEHIQYLKNYFHLWTRQLAHIY    281 - 350
HYYIHGPKGNEIRTSKEVEPFNNIDIEISMFEKGKVPKIVNLREIQDDMQTLYVNTAADSFEFKAHVEGD    351 - 420
GVVEGIIRYHPFLYDRETYPDDPCFPSKLKDEDDEDDCFILEKAARGKRPIFECFWNGRLIPYTSVEDFD    421 - 490
WCTPPKKRGLAPIECYNRISGALFTNDKFQVSTNKLTFMDLELKLKDKNTLFTRILNGQEQRMKIDREFA    491 - 560
LWLKDCHEKYDKQIKFTLFKGVITRPDLPSKKQGPWATYAAIEWDGKIYKAGQLVKTIKTLPLFYGSIVR    561 - 630
FFLYGDHDGEVYATGGEVQIAMEPQALYDEVRTVPIAKLDRTVAEKAVKKYVEDEMARLPDRLSVTWPEG    631 - 700
DELLPNEVRPAGTPIGALRIEILNKKGEAMQKLPGTSHGGSKKLLVELKVILHSSSGNKEIISHISQHGG    701 - 770
KWPYWFKKMENIQKLGNYTLKLQVVLNESNADTYAGRPLPSKAIKFSVKEGKPEKFSFGLLDLPFRVGVP    771 - 840
FNIPLEFQDEFGHTSQLVTDIQPVLEASGLSLHYEEITKGPNCVIRGVTAKGPVNSCQGKNYNLKVTLPG    841 - 910
LKEDSQILKIRLLPGHPRRLKVKPDSEILVIENGTAFPFQVEVLDESDNITAQPKLIVHCKFSGAPNLPV    911 - 980
YVVDCSSSGTSILTGSAIQVQNIKKDQTLKARIEIPSCKDVAPVEKTIKLLPSSHVARLQIFSVEGQKAI    981 - 1050
QIKHQDEVNWIAGDIMHNLIFQMYDEGEREINITSALAEKIKVNWTPEINKEHLLQGLLPDVQVPTSVKD   1051 - 1120
MRYCQVSFQDDHVSLESAFTVRPLPDEPKHLKCEMKGGKTVQMGQELQGEVVIIITDQYGNQIQAFSPSS   1121 - 1190
LSSLSIAGVGLDSSNLKTTFQENTQSISVRGIKFIPGPPGNKDLCFTWREFSDFIRVQLISGPPAKLLLI   1191 - 1260
DWPELKESIPVINGRDLQNPIIVQLCDQWDNPAPVQHVKISLTKASNLKLMPSNQQHKTDEKGRANLGVF   1261 - 1330
SVFAPRGEHTLQVKAIYNKSIIEGPIIKLMILPDPEKPVRLNVKYDKDASFLAGGLFTDFMISVISEDDS   1331 - 1400
IIKNINPARISMKMWKLSTSGNRPPANAETFSCNKIKDNDKEDGCFYFRDKVIPNKVGTYCIQFGFMMDK   1401 - 1470
TNILNSEQVIVEVLPNQPVKLVPKIKPPTPAVSNVRSVASRTLVRDLHLSITDDYDNHTGIDLVGTIIAT   1471 - 1540
IKGSNEEDTDTPLFIGKVRTLEFPFVNGSAEIMSLVLAESSPGRDSTEYFIVFEPRLPLLSRTLEPYILP   1541 - 1610
FMFYNDVKKQQQMAALTKEKDQLSQSIVMYKSLFEASQQLLNEMKCQVEEARLKEAQLRNELKIHNIDIP   1611 - 1680
TTQQVPHIEALLKRKLSEQEELKKKPRRSCTLPNYTKGSGDVLGKIAHLAQIEDDRAAMVISWHLASDMD   1681 - 1750
CVVTLTTDAARRIYDETQGRQQVLPLDSIYKKTLPDWKRSLPHFRNGKLYFKPIGDPVFARDLLTFPDNV   1751 - 1820
EHCETVFGMLLGDTIILDNLDAANHYRKEVVKITHCPTLLTRDGDRIRSNGKFGGLQNKAPPMDKLRGMV   1821 - 1890
FGAPVPKQCLILGEQIDLLQQYRSAVCKLDSVNKDLNSQLEYLRTPDMRKKKQELDEHEKNLKLIEEKLG   1891 - 1960
MTPIRKCNDSLRHSPKVETTDCPVPPKRMRREATRQNRIITKTDV                            1961 - 2005
//

Text Mined References (41)

PMID Year Title