Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NHR8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGDQRPRDRPRSPGMDCKPWYCDKPPSKYIAKRKHRRLRFPPMDTQNWVFVKESMDSFHYGCPSPEDMLI      1 - 70
CRLNEFLLPKISHRGPQADPKSRQKKLLKKVALFSKLLPAQPAWKAFVEEAQLMAKHPLAMYPNLGEDMP     71 - 140
PDLLLQMLKLLDPERKLEKAWAYCEGREKTIKEPTKPEPPKAPVSHHFLEPPKIRASCLKELLQEDTPST    141 - 210
TECVSDSLQHRYTSRKMHDFKWARDMGVDEESIRNLFDFTPKWRATYEDQQIKKIKEWVSELQYRIKLDE    211 - 280
MDEVESSQEKDWDRKLQMAPNSYTAQCVKMRYGVWYLKPKLGKKLRSDQPLIDPKLLLEKPDEPDILDDL    281 - 350
YGPIAFKDFILSKGYEMPGIIERLCARKGWTYDSVKTPVQRAMRLYK                           351 - 397
//

Text Mined References (1)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.