Property Summary

NCBI Gene PubMed Count 2
PubMed Score 2.27
PubTator Score 0.59

Knowledge Summary

Patent

No data available

AA Sequence

METLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPLCLRALAFCALAKPRASSLGPGPGELAARSPVL      1 - 70
RGPQAPLRPGGWAPDGLKHLWAPTGRPGVPNTAAGEDADVAACPRRGEEEEGGGGFPHFGVRSCAPPGRC     71 - 140
PAPPHPRESTTSFASAPPRPAPGLEPQRGPAASPPQEPSSRPPSPPAGLSTEPAGPGTAPRPFLPGQPAE    141 - 210
VDGNPPPAAPEAPAASPSTASPAPAAPGDLRQEHFDRLIRRSKLWCYAKGFALDTPSLRRGPERPPAKGP    211 - 280
ARGAAKKRRLPAPPPRTAQPRRPAPTLPTTSTFSLLNCFPCPPALVVGEDGDLKPASSLRLQGDSKPPPA    281 - 350
HPLWRWQMGGPAVPEPPGLKFWGINMDES                                             351 - 379
//

Text Mined References (4)

PMID Year Title
24550272 2014 Reciprocal interactions of human C10orf12 and C17orf96 with PRC2 revealed by BioTAP-XL cross-linking and affinity purification.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.