Property Summary

NCBI Gene PubMed Count 4
PubMed Score 2.27
PubTator Score 0.59

Knowledge Summary

Patent

No data available

Synonym

Accession A6NHQ4
Symbols PRR28
C17orf96

Gene

  Ortholog (1)

Species Source Disease
Mouse OMA Inparanoid

AA Sequence

METLCPAPRLAVPASPRGSPCSPTPRKPCRGTQEFSPLCLRALAFCALAKPRASSLGPGPGELAARSPVL      1 - 70
RGPQAPLRPGGWAPDGLKHLWAPTGRPGVPNTAAGEDADVAACPRRGEEEEGGGGFPHFGVRSCAPPGRC     71 - 140
PAPPHPRESTTSFASAPPRPAPGLEPQRGPAASPPQEPSSRPPSPPAGLSTEPAGPGTAPRPFLPGQPAE    141 - 210
VDGNPPPAAPEAPAASPSTASPAPAAPGDLRQEHFDRLIRRSKLWCYAKGFALDTPSLRRGPERPPAKGP    211 - 280
ARGAAKKRRLPAPPPRTAQPRRPAPTLPTTSTFSLLNCFPCPPALVVGEDGDLKPASSLRLQGDSKPPPA    281 - 350
HPLWRWQMGGPAVPEPPGLKFWGINMDES                                             351 - 379
//

Text Mined References (6)

PMID Year Title