Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 6.64459089061767E-39
posterior fossa group A ependymoma 1511 5.08922623539211E-17
inflammatory breast cancer 404 3.02342434774903E-4
medulloblastoma, large-cell 6234 7.46604118786083E-4
atypical teratoid / rhabdoid tumor 4369 0.00250089883473076
glioblastoma 5572 0.00650277232606299
pediatric high grade glioma 2712 0.00758050957742074
subependymal giant cell astrocytoma 2287 0.031941690784406

Expression

  Differential Expression (8)

Synonym

Accession A6NHQ2 R4GMW7
Symbols

Gene

AA Sequence

MKSAASSRGGGGGGRGGGGWGSWGGGRGGGGGAGKGGGGDGGGQGGKGGFGARARGFGGGGRGRGRGGGD      1 - 70
GKDRGGGGQRRGGVAKSKSRRRKGAMVVSVEPHRHEGVFIYRGAEDALVTLNMVPGQSVYGERRVTVTEG     71 - 140
GVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGR    141 - 210
DLVNVAKKRTNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANC    211 - 280
IDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLPKSSSK                    281 - 334
//

Text Mined References (2)

PMID Year Title
24639526 2014 RSPO-LGR4 functions via IQGAP1 to potentiate Wnt signaling.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.