Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 3.2e-03
atypical teratoid / rhabdoid tumor -1.500 2.5e-03
ependymoma -2.200 3.2e-13
glioblastoma -1.500 6.5e-03
inflammatory breast cancer -2.200 3.0e-04
lung carcinoma 1.600 6.6e-39
medulloblastoma, large-cell -1.100 7.5e-04
subependymal giant cell astrocytoma -1.619 3.2e-02

AA Sequence

MKSAASSRGGGGGGRGGGGWGSWGGGRGGGGGAGKGGGGDGGGQGGKGGFGARARGFGGGGRGRGRGGGD      1 - 70
GKDRGGGGQRRGGVAKSKSRRRKGAMVVSVEPHRHEGVFIYRGAEDALVTLNMVPGQSVYGERRVTVTEG     71 - 140
GVKQEYRTWNPFRSKLAAAILGGVDQIHIKPKSKVLYLGAASGTTVSHVSDIIGPDGLVYAVEFSHRAGR    141 - 210
DLVNVAKKRTNIIPVLEDARHPLKYRMLIGMVDVIFADVAQPDQSRIVALNAHTFLRNGGHFLISIKANC    211 - 280
IDSTASAEAVFASEVRKLQQENLKPQEQLTLEPYERDHAVVVGVYRPLPKSSSK                    281 - 334
//

Text Mined References (2)

PMID Year Title