Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Chordoma 7 4.15 2.1

Expression

Synonym

Accession A6NHN6 C9J9U8
Symbols NPIPL2
A-761H5.4

Gene

AA Sequence

MRLRFWLLIWLLLGFISHQPTPVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQKLDNLIIIIIGFLRR      1 - 70
DTFTILFCTSYLCVSFLKTIFWSRNGHDGSTDVQQRAWRSNRSRQKGLRSICMHTKKRVSSFRGNKIGLK     71 - 140
DVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKP    141 - 210
LCNWVRMAAAEHRHSSGLPCWPYLTAEALKNRMGRQPPPPTQQHSITDNSLSLKTPPECLLHPLPPSVDD    211 - 280
NIKECPLAPLPPSVDDNLKEYLLVPLPPSPLPPSVDDNLKDCLFVPLPPSPLPPSVDDNLKTPPLATQEA    281 - 350
EAEKPPKPKRWRVDEVEQSPKPKRRRADEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCTQAWAIR    351 - 420
INPWVEKKKKIKKQNKTHAPKTN                                                   421 - 443
//

Text Mined References (2)

PMID Year Title