Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Chordoma 5 4.16 2.1

Expression

AA Sequence

MRLRFWLLIWLLLGFISHQPTPVINSLAVYRHRETDFGVGVRDHPGQHGKTPSPQKLDNLIIIIIGFLRR      1 - 70
DTFTILFCTSYLCVSFLKTIFWSRNGHDGSTDVQQRAWRSNRSRQKGLRSICMHTKKRVSSFRGNKIGLK     71 - 140
DVITLRRHVETKVRAKIRKRKVTTKINRHDKINGKRKTARKQKMFQRAQELRRRAEDYHKCKIPPSARKP    141 - 210
LCNWVRMAAAEHRHSSGLPCWPYLTAEALKNRMGRQPPPPTQQHSITDNSLSLKTPPECLLHPLPPSVDD    211 - 280
NIKECPLAPLPPSVDDNLKEYLLVPLPPSPLPPSVDDNLKDCLFVPLPPSPLPPSVDDNLKTPPLATQEA    281 - 350
EAEKPPKPKRWRVDEVEQSPKPKRRRADEVEQSPKPKRQREAEAQQLPKPKRRRLSKLRTRHCTQAWAIR    351 - 420
INPWVEKKKKIKKQNKTHAPKTN                                                   421 - 443
//

Text Mined References (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
10493829 1999 Genome duplications and other features in 12 Mb of DNA sequence from human chromosome 16p and 16q.