Property Summary

NCBI Gene PubMed Count 7
Grant Count 3
R01 Count 3
Funding $585,605.5
PubMed Score 7.87
PubTator Score 4.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Gene RIF (3)

PMID Text
24748133 calcium carbonate crystal growth data demonstrate that Otolin-1 and OC90 modulate in vitro calcite crystal morphology but neither protein is sufficient to produce the shape of otoconia
20966902 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
15905077 Identification and functional characterization of a similar protein in zebrafish.

AA Sequence

MWMFSWLCAILIILAIAGMNTIAKTTPHTKFTKKSEEREMPKGLKPSSGPPPEEEETLFTEMAEMAEPIT      1 - 70
KPSALDSVFGTATLSPFENFTLDPADFFLNCCDCCSPVPGQKGEPGETGQPGPKGEAGNLGIPGPPGVVG     71 - 140
PQGPRGYKGEKGLKGERGDQGVPGYPGKPGAQGEPGPKGDKGNIGLGGVKGQKGSKGDTCGNCTKGEKGD    141 - 210
QGAMGSPGLHGGPGAKGEKGEMGEKGEMGDKGCCGDSGERGGKGQKGEGGMKGEKGSKGDSGMEGKSGRN    211 - 280
GLPGAKGDPGIKGEKGELGPPGLLGPTGPKGDIGNKGVRGPTGKKGSRGFKGSKGELARVPRSAFSAGLS    281 - 350
KPFPPPNIPIKFEKILYNDQGNYSPVTGKFNCSIPGTYVFSYHITVRGRPARISLVAQNKKQFKSRETLY    351 - 420
GQEIDQASLLVILKLSAGDQVWLEVSKDWNGVYVSAEDDSIFTGFLLYPEETSGISP                 421 - 477
//

Text Mined References (7)

PMID Year Title
24748133 2014 In vitro calcite crystal morphology is modulated by otoconial proteins otolin-1 and otoconin-90.
21782286 2011 A genome-wide association study of aging.
20966902 2011 Genome-wide association study of anthropometric traits and evidence of interactions with age and study year in Filipino women.
17544811 2007 C1q and its growing family.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15905077 2005 Otolith matrix proteins OMP-1 and Otolin-1 are necessary for normal otolith growth and their correct anchoring onto the sensory maculae.
11181995 2001 The sequence of the human genome.