Property Summary

NCBI Gene PubMed Count 14
PubMed Score 0.00
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
17642472 it is proposed that modification or inactivation of MOXD2 and S100A15A genes have contributed to the loss of certain smell sense in humans and to the development of human skin

AA Sequence

MAHDLLFRLFPLLALGVPLQSNRLGPTSRLRYSRFLDPSNVIFLRWDFDLEAEIISFELQVRTAGWVGFG      1 - 70
VTNRYTNVGSDLVVGGVLPNGNVYFSDQHLVEEDTLKEDGSQDAELLGLTEDAVYTTMHFSRPFRSCDPH     71 - 140
DLDITSNTVRVLAAYGLDDTLKLYRERTFVKSIFLLQVVHPDDLDVPEDTIIHDLEITNFLIPEDDTTYA    141 - 210
CTFLPLPIVSEKHHIYKFEPKLVYHNETTVHHILVYACGNASVLPTGISDCYGADPAFSLCSQVIVGSAV    211 - 280
GGTSYQFPDDVGVSIGTPLDPQWILEIHYSNFNNLPGVYDSSGIRVYYTSQLCKYDTDVLQLGFFTFPIH    281 - 350
FIPPGAESFMSYGLCRTEKFEEMNGAPMPDIQVYGYLLHTHLAGRALQAVQYRNGTQLRKICKDDSYDFN    351 - 420
LQETRDLPSRVEIKPGDELLVECHYQTLDRDSMTFGGPSTINEMCLIFLFYYPQNNISSCMGYPDIIYVA    421 - 490
HELGEEASE                                                                 491 - 499
//

Text Mined References (14)

PMID Year Title
19380806 2009 Assembled DJ beta complexes influence TCR beta chain selection and peripheral V beta repertoire.
19056690 2009 An early decrease in Notch activation is required for human TCR-alphabeta lineage differentiation at the expense of TCR-gammadelta T cells.
19051206 Autoreactive T-cell receptor (Vbeta/D/Jbeta) sequences in diabetes are homologous to insulin, glucagon, the insulin receptor, and the glucagon receptor.
18777093 2008 Different allelic distribution of a single SNP between sexes in humans.
18523312 2008 CD4+ T cells target epitopes residing within the RNA-binding domain of the U1-70-kDa small nuclear ribonucleoprotein autoantigen and have restricted TCR diversity in an HLA-DR4-transgenic murine model of mixed connective tissue disease.
17642472 2007 Inactivation of MOXD2 and S100A15A by exon deletion during human evolution.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
8650574 1996 The complete 685-kilobase DNA sequence of the human beta T cell receptor locus.
3983641 1985 Location of gene for beta subunit of human T-cell receptor at band 7q35, a region prone to rearrangements in T cells.
More...