Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.32
PubTator Score 0.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.437 0.000
colon cancer -2.000 0.027
active Crohn's disease -1.766 0.018
ulcerative colitis -2.700 0.000
facioscapulohumeral dystrophy 2.200 0.004

Gene RIF (2)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of tubulin, alpha-like 3 (TUBAL3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFFCETRAGKHVP      1 - 70
RALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVLERTRKLAEQCGGLQ     71 - 140
GFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNSVLTTHSTTEHTDCTFM    141 - 210
VDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFA    211 - 280
PIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQF    281 - 350
VDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM    351 - 420
EEAEFLEAREDLAALERDYEEVAQSF                                                421 - 446
//

Text Mined References (6)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.