Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.32
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
ulcerative colitis 2087 6.54244274721043E-6
osteosarcoma 7933 1.84374575495095E-4
facioscapulohumeral dystrophy 286 0.00434815115949414
active Crohn's disease 918 0.0182385375035645
colon cancer 1475 0.0268326684436607

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.437 0.000
colon cancer -2.000 0.027
active Crohn's disease -1.766 0.018
ulcerative colitis -2.700 0.000
facioscapulohumeral dystrophy 2.200 0.004

Synonym

Accession A6NHL2 B4DKL2 Q4QQJ5 Q9H6Z0
Symbols

Gene

  Ortholog (5)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid

Gene RIF (2)

PMID Text
19240061 Observational study of gene-disease association. (HuGE Navigator)
18187620 Knockdown of tubulin, alpha-like 3 (TUBAL3) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells

AA Sequence

MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFFCETRAGKHVP      1 - 70
RALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVLERTRKLAEQCGGLQ     71 - 140
GFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNSVLTTHSTTEHTDCTFM    141 - 210
VDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFA    211 - 280
PIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQF    281 - 350
VDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM    351 - 420
EEAEFLEAREDLAALERDYEEVAQSF                                                421 - 446
//

Text Mined References (6)

PMID Year Title
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.