Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.32
PubTator Score 0.56

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ulcerative colitis 1819 6.5e-06
osteosarcoma 7950 1.8e-04
facioscapulohumeral dystrophy 288 4.3e-03
active Crohn's disease 922 1.8e-02
colon cancer 1478 2.7e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (5)

Disease log2 FC p
active Crohn's disease -1.766 1.8e-02
colon cancer -2.000 2.7e-02
facioscapulohumeral dystrophy 2.200 4.3e-03
osteosarcoma -1.437 1.8e-04
ulcerative colitis -2.700 6.5e-06

Protein-protein Interaction (11)

Gene RIF (2)

AA Sequence

MRECLSIHIGQAGIQIGDACWELYCLEHGIQPNGVVLDTQQDQLENAKMEHTNASFDTFFCETRAGKHVP      1 - 70
RALFVDLEPTVIDGIRTGQHRSLFHPEQLLSGKEDAANNYARGRYSVGSEVIDLVLERTRKLAEQCGGLQ     71 - 140
GFLIFRSFGGGTGSGFTSLLMERLTGEYSRKTKLEFSVYPAPRISTAVVEPYNSVLTTHSTTEHTDCTFM    141 - 210
VDNEAVYDICHRKLGVECPSHASINRLVVQVVSSITASLRFEGPLNVDLIEFQTNLVPYPRIHFPMTAFA    211 - 280
PIVSADKAYHEQFSVSDITTACFESSNQLVKCDPRLGKYMACCLLYRGDVVPKEVNAAIAATKSRHSVQF    281 - 350
VDWCPTGFKVGINNRPPTVMPGGDLAKVHRSICMLSNTTAIVEAWARLDHKFDLMYAKRAFLHWYLREGM    351 - 420
EEAEFLEAREDLAALERDYEEVAQSF                                                421 - 446
//

Text Mined References (6)

PMID Year Title