Property Summary

NCBI Gene PubMed Count 9
PubMed Score 0.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Velocardiofacial syndrome 46 3.598 1.8

Expression

Synonym

Accession A6NHG4 B4DJJ7
Symbols KB-226F1.2

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Mouse OMA EggNOG Inparanoid

Gene RIF (3)

AA Sequence

MPFLELDTNLPANRVPAGLEKRLCAAAASILGKPADRVNVTVRPGLAMALSGSTEPCAQLSISSIGVVGT      1 - 70
AEDNRSHSAHFFEFLTKELALGQDRFPTVLSTSPAAHGGPRCPGEIIEGKKSCLNEEALFIYFI           71 - 134
//

Text Mined References (9)

PMID Year Title