Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
R01 Count 4
Funding $377,444.75
PubMed Score 20.74
PubTator Score 13.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (1)

PMID Text
17646163 nCL-2/calpain 8 is active without calpain regulatory subunit and oligomerizes through C2-like domains

AA Sequence

MAAQAAGVSRQRAATQGLGSNQNALKYLGQDFKTLRQQCLDSGVLFKDPEFPACPSALGYKDLGPGSPQT      1 - 70
QGIIWKRPTELCPSPQFIVGGATRTDICQGGLGDCWLLAAIASLTLNEELLYRVVPRDQDFQENYAGIFH     71 - 140
FQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGCYEALAGGSTVEGFEDFTGG    141 - 210
ISEFYDLKKPPANLYQIIRKALCAGSLLGCSIDVSSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPEK    211 - 280
LIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVEDGEFWMSLSDFVRQFSRLEICNLSPDSLSS    281 - 350
EEVHKWNLVLFNGHWTRGSTAGGCQNYPATYWTNPQFKIRLDEVDEDQEESIGEPCCTVLLGLMQKNRRW    351 - 420
RKRIGQGMLSIGYAVYQVPKELESHTDAHLGRDFFLAYQPSARTSTYVNLREVSGRARLPPGEYLVVPST    421 - 490
FEPFKDGEFCLRVFSEKKAQALEIGDVVAGNPYEPHPSEVDQEDDQFRRLFEKLAGKDSEITANALKILL    491 - 560
NEAFSKRTDIKFDGFNINTCREMISLLDSNGTGTLGAVEFKTLWLKIQKYLEIYWETDYNHSGTIDAHEM    561 - 630
RTALRKAGFTLNSQVQQTIALRYACSKLGINFDSFVACMIRLETLFKLFSLLDEDKDGMVQLSLAEWLCC    631 - 700
VLV                                                                       701 - 703
//

Text Mined References (11)

PMID Year Title
17646163 2007 Stomach-specific calpain, nCL-2/calpain 8, is active without calpain regulatory subunit and oligomerizes through C2-like domains.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11523006 2001 Both the conserved and the unique gene structure of stomach-specific calpains reveal processes of calpain gene evolution.
11516996 2001 The calpain family and human disease.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
8889549 1996 Generation and analysis of 280,000 human expressed sequence tags.
More...