Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 0.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.6e-06

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma 1.640 1.6e-06

AA Sequence

MGQLIAKLMSIFGNQEHTVIIVGLDNEGKTTILYRFLTNEVVHMCPTIGSNVEEIILPKTHFFMWDIVRP      1 - 70
EALSFIWNTYYSNTEFIILVIDSTDRDRLLTTREELYKMLAHEALQDASVLIFANKQDVKDSMRMVEISH     71 - 140
FLTLSTIKDHSWHIQGCCALTREGLPARLQWMESQAAAN                                   141 - 179
//

Text Mined References (2)

PMID Year Title