Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Synonym

Accession A6NH13
Symbols C10orf103
bA537A6.3

 Compartment GO Term (0)

AA Sequence

MPGGDTTPEEAAAPSCAGYNPGLLLFRAQKAQGACVTSTEGAWPRRASALYGGRKMRCGESGAGPDPRSN      1 - 70
SAEVSSSQPALASKSQSKWGPTSNNPRGALTTTEFEMAGNRSQNIKHKQTALIAIPMSSQTPRMLGRPRN     71 - 140
QGQLYPQP                                                                  141 - 148
//

Text Mined References (3)

PMID Year Title