Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

AA Sequence

MEPQKLLIIGFLLCSLTCLLLETVASSPLPLSALGIQEKTGSKPRSGGNHRSWLNNFRDYLWQLIKSALP      1 - 70
PAAIVAFLLTSALMGILCCFTILVVDPVH                                              71 - 99
//

Text Mined References (4)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
11329013 2001 Creation of genome-wide protein expression libraries using random activation of gene expression.
11181995 2001 The sequence of the human genome.