Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hemolytic anemia 77 0.0 3.0
Malaria 160 0.0 3.0

AA Sequence

MLQNQDTMEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYY      1 - 70
FLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLR     71 - 140
YTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLI    141 - 210
DLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRV    211 - 280
VHSVMANVYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK                                   281 - 319
//

Text Mined References (7)

PMID Year Title