Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.25
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Hemolytic anemia 66 2.0
Malaria 140 2.0

Synonym

Accession A6NGY5
Symbols OR11-21
OR51F1P

Gene

PANTHER Protein Class (2)

AA Sequence

MLQNQDTMEILSNSTSKFPTFLLTGIPGLESAHVWISIPFCCFYAIALSGNSVILFVIITQQSLHEPMYY      1 - 70
FLFRLSATDLGLTVSSLSTTLGILWFEAREISLYSCIVQMFFLHGFTFMESGVLVATAFDRYVAICDPLR     71 - 140
YTTILTNSRIIQMGLLMITRAIVLILPLLLLLKPLYFCRMNALSHSYCYHPDVIQLACSDIRANSICGLI    141 - 210
DLILTTGIDTPCIVLSYILIIHSVLRIASPEEWHKVFSTCVSHVGAVAFFYIHMLSLSLVYRYGRSAPRV    211 - 280
VHSVMANVYLLLPPVLNPIIDSVKTKQIRKAMLSLLLTK                                   281 - 319
//

Text Mined References (7)

PMID Year Title
23717212 2013 Imputation-based meta-analysis of severe malaria in three African populations.
22908908 2012 Personal receptor repertoires: olfaction as a model.
16939646 2006 A probabilistic classifier for olfactory receptor pseudogenes.
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
14983052 2004 The human olfactory receptor gene family.
12730696 2003 Different noses for different people.
12644552 2003 Population differences in the human functional olfactory repertoire.