Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 1.9e-06
facioscapulohumeral dystrophy 288 6.1e-04
Disease Target Count Z-score Confidence
Ankylosing spondylitis 140 3.041 1.5

AA Sequence

MGKGNEDPDLHCSSIQCSTDQPPFQQISFTEKGSDEKKPFKGKGKTAFSHSSEKHTQRQAGSDPNPNKEN      1 - 70
SEETKLKAGNSTAGSEPESSSYQENCRKRKISSKDICQDRAGNCPEEECNLTLNKKSRSSTAVHNSEIQE     71 - 140
TCDAHHRGSSRACTGRSKRHRSRALEVQTPSLRKSLVTSVRAMSEAVYQDLAQVWAQQIHSPLTCEQLTL    141 - 210
LTRLRGPLCAQVQTLYSMATQAAYVFPAESWLVPATLPGPGDSALDREAHPFPGQEITEPVSGSDEAKLG    211 - 280
AP                                                                        281 - 282
//

Text Mined References (3)

PMID Year Title