Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NGU7
Symbols CXorf28

 Compartment GO Term (0)

AA Sequence

MGELAASANHGHSPCYPERKGTPGDLSKRKMLVHFYPRRHSHPRATQQWILKNKTLCRRIKE              1 - 62
//

Text Mined References (3)

PMID Year Title