Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NGU7
Symbols CXorf28

Gene

 Compartment GO Term (0)

AA Sequence

MGELAASANHGHSPCYPERKGTPGDLSKRKMLVHFYPRRHSHPRATQQWILKNKTLCRRIKE              1 - 62
//

Text Mined References (3)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.