Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus 1.100 1.4e-03
inflammatory breast cancer 1.400 1.8e-02
lung adenocarcinoma 1.100 1.4e-08
pancreatic ductal adenocarcinoma liver m... 1.072 2.3e-03

Synonym

Accession A6NGR9 A8MWB1
Symbols C8orf73

Gene

  Ortholog (1)

Species Source Disease
Rat OMA EggNOG Inparanoid

 GO Function (1)

 Compartment GO Term (2)

AA Sequence

MAGGVWGRSRAREAPVGALTLTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPG      1 - 70
RGATVPEAGSEPCSLNSALEPAPEGPHQVPQSSWEEGVLADLALYTAACLEEAGFAGTQATVLTLSSALE     71 - 140
ARGERLEDQVHALVRGLLAQVPSLAEGRPWRAALRVLSALALEHARDVVCALLPRSLPADRVAAELWRSL    141 - 210
SRNQRVNGQVLVQLLWALKGASGPEPQALAATRALGEMLAVSGCVGATRGFYPHLLLALVTQLHKLARSP    211 - 280
CSPDMPKIWVLSHRGPPHSHASCAVEALKALLTGDGGRMVVTCMEQAGGWRRLVGAHTHLEGVLLLASAM    281 - 350
VAHADHHLRGLFADLLPRLRSADDPQRLTAMAFFTGLLQSRPTARLLREEVILERLLTWQGDPEPTVRWL    351 - 420
GLLGLGHLALNRRKVRHVSTLLPALLGALGEGDARLVGAALGALRRLLLRPRAPVRLLSAELGPRLPPLL    421 - 490
DDTRDSIRASAVGLLGTLVRRGRGGLRLGLRGPLRKLVLQSLVPLLLRLHDPSRDAAESSEWTLARCDHA    491 - 560
FCWGLLEELVTVAHYDSPEALSHLCCRLVQRYPGHVPNFLSQTQGYLRSPQDPLRRAAAVLIGFLVHHAS    561 - 630
PGCVNQDLLDSLFQDLGRLQSDPKPAVAAAAHVSAQQVAMLARARGCPRGPRLLRIAPRPARPPPVFADS    631 - 700
PFQRRSVAGRWGCSGPRRA                                                       701 - 719
//

Text Mined References (4)

PMID Year Title