Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Synonym

Accession A6NGR9 A8MWB1
Symbols C8orf73

Gene

 Compartment GO Term (1)

AA Sequence

MAGGVWGRSRAREAPVGALTLTALTEGIRARQGQPQGPPSAGPQPKSWEVKPEAEPQTQALTAPSEAEPG      1 - 70
RGATVPEAGSEPCSLNSALEPAPEGPHQVPQSSWEEGVLADLALYTAACLEEAGFAGTQATVLTLSSALE     71 - 140
ARGERLEDQVHALVRGLLAQVPSLAEGRPWRAALRVLSALALEHARDVVCALLPRSLPADRVAAELWRSL    141 - 210
SRNQRVNGQVLVQLLWALKGASGPEPQALAATRALGEMLAVSGCVGATRGFYPHLLLALVTQLHKLARSP    211 - 280
CSPDMPKIWVLSHRGPPHSHASCAVEALKALLTGDGGRMVVTCMEQAGGWRRLVGAHTHLEGVLLLASAM    281 - 350
VAHADHHLRGLFADLLPRLRSADDPQRLTAMAFFTGLLQSRPTARLLREEVILERLLTWQGDPEPTVRWL    351 - 420
GLLGLGHLALNRRKVRHVSTLLPALLGALGEGDARLVGAALGALRRLLLRPRAPVRLLSAELGPRLPPLL    421 - 490
DDTRDSIRASAVGLLGTLVRRGRGGLRLGLRGPLRKLVLQSLVPLLLRLHDPSRDAAESSEWTLARCDHA    491 - 560
FCWGLLEELVTVAHYDSPEALSHLCCRLVQRYPGHVPNFLSQTQGYLRSPQDPLRRAAAVLIGFLVHHAS    561 - 630
PGCVNQDLLDSLFQDLGRLQSDPKPAVAAAAHVSAQQVAMLARARGCPRGPRLLRIAPRPARPPPVFADS    631 - 700
PFQRRSVAGRWGCSGPRRA                                                       701 - 719
//

Text Mined References (4)

PMID Year Title
16421571 2006 DNA sequence and analysis of human chromosome 8.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9776767 1998 A method for global protein expression and antibody screening on high-density filters of an arrayed cDNA library.