Property Summary

NCBI Gene PubMed Count 3
Grant Count 1
Funding $442,519.5
PubMed Score 3.57
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Infertility 163 3.296 1.6

Expression

AA Sequence

MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAII      1 - 70
PEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASD     71 - 140
PHSPQDPVA                                                                 141 - 149
//

Text Mined References (5)

PMID Year Title
26537248 2015 TLE6 mutation causes the earliest known human embryonic lethality.
17913455 2007 Atypical structure and phylogenomic evolution of the new eutherian oocyte- and embryo-expressed KHDC1/DPPA5/ECAT1/OOEP gene family.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11181995 2001 The sequence of the human genome.