Property Summary

NCBI Gene PubMed Count 4
PubMed Score 4.20
PubTator Score 0.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Infertility 188 3.281 1.6

Expression

Synonym

Accession A6NGQ2 A6NIN5 A9UIB7
Symbols KHDC2
FLOPED
HOEP19
C6orf156

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MVDDAGAAESQRGKQTPAHSLEQLRRLPLPPPQIRIRPWWFPVQELRDPLVFYLEAWLADELFGPDRAII      1 - 70
PEMEWTSQALLTVDIVDSGNLVEITVFGRPRVQNRVKSMLLCLAWFHREHRARAEKMKHLEKNLKAHASD     71 - 140
PHSPQDPVA                                                                 141 - 149
//

Text Mined References (5)

PMID Year Title