Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 0.00190610846573993

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 0.002

AA Sequence

MSWRGRSTYRSRPRLYVEPPEMIGPMLPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEADSQEQVHPKTGCECGDGPDGQEMGLPNPEEVKRPEEGEKQSQC                             71 - 116
//

Text Mined References (3)

PMID Year Title
18179644 2008 An overview of the GAGE cancer/testis antigen family with the inclusion of newly identified members.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.