Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.9e-03

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.500 1.9e-03

AA Sequence

MSWRGRSTYRSRPRLYVEPPEMIGPMLPEQFSDEVEPATPEEGEPATQRQDPAAAQEGEDEGASAGQGPK      1 - 70
PEADSQEQVHPKTGCECGDGPDGQEMGLPNPEEVKRPEEGEKQSQC                             71 - 116
//

Text Mined References (3)

PMID Year Title