Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NGH8
Symbols

Gene

 Compartment GO Term (0)

AA Sequence

MGNITRKGSRDLVVDSAKSLEDGPSAALHSKLYEAIMREDCTTIEVLLRNHPVNQPITILPNSASNRLLL      1 - 70
TQPTESIIPIHLAAKYHKAQSLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTD     71 - 140
IQNSSITCLRILCAHGAQVNTQGEISNKRSPLHLAIAYGCYPVLSILTQNGADVNAINEASMTPLHMAAN    141 - 210
MLNKEMMETLIAYGANVNCAVSSTGNTPLKLAVCTASSKAGRLLGAGVSCIRLLLTHGAKVNAQDYKGQT    211 - 280
AIHEACFGGREAIINLLLEFEANVNILTRNGESPIYMYLQRSCNVRDTALLARLLYHTYPLRMTNNQGIL    281 - 350
PAGIMLPEFRLLRDTLIKQSQKPLSLQGICKRNIRNIYGEKYKQHLKQFLPVTIWNSVYCCYDLAYTS      351 - 418
//

Text Mined References (1)

PMID Year Title
12853948 2003 The DNA sequence of human chromosome 7.