Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

  Differential Expression (2)

Disease log2 FC p
posterior fossa group B ependymoma 1.900 0.000
pilocytic astrocytoma 1.300 0.000

AA Sequence

MDARRKHWKENMFTPFFSAQDVLEETSEPESSSEQTTADSSKGMEEIYNLSSRKFQEESKFKRKKYIFQL      1 - 70
NEIEQEQNLRENKRNISKNETDTNSASYESSNVDVTTEESFNSTEDNSTCSTDNLPALLRQDIRKKFMER     71 - 140
MSPKLCLNLLNEELEELNMKYRKIEEEFENAEKELLHYKKEIFTKPLNFQETETDASKSDYELQALRNDL    141 - 210
SEKATNVKNLSEQLQQAKEVIHKLNLENRNLKEAVRKLKHQTEVGNVLLKEEMKSYYELEMAKIRGELSV    211 - 280
IKNELRTEKTLQARNNRALELLRKYYASSMVTSSSILDHFTGDFF                             281 - 325
//

Text Mined References (3)

PMID Year Title
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
15772651 2005 The DNA sequence of the human X chromosome.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.