Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 4.7e-06
Astrocytoma, Pilocytic 3081 1.1e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (2)

Disease log2 FC p
Astrocytoma, Pilocytic 1.300 1.1e-04
ependymoma 1.300 4.7e-06

AA Sequence

MDARRKHWKENMFTPFFSAQDVLEETSEPESSSEQTTADSSKGMEEIYNLSSRKFQEESKFKRKKYIFQL      1 - 70
NEIEQEQNLRENKRNISKNETDTNSASYESSNVDVTTEESFNSTEDNSTCSTDNLPALLRQDIRKKFMER     71 - 140
MSPKLCLNLLNEELEELNMKYRKIEEEFENAEKELLHYKKEIFTKPLNFQETETDASKSDYELQALRNDL    141 - 210
SEKATNVKNLSEQLQQAKEVIHKLNLENRNLKEAVRKLKHQTEVGNVLLKEEMKSYYELEMAKIRGELSV    211 - 280
IKNELRTEKTLQARNNRALELLRKYYASSMVTSSSILDHFTGDFF                             281 - 325
//

Text Mined References (3)

PMID Year Title