Property Summary

NCBI Gene PubMed Count 2
Grant Count 6
R01 Count 6
Funding $4,508,157
PubMed Score 6.00
PubTator Score 2.50

Knowledge Summary

Patent

No data available

AA Sequence

MDIEKVNSMDLGEFVDVFGNATERCPLIAAAVWSQRPFSDLEDLEKHFFAFIDALAQSGQEGILRCHPDL      1 - 70
AGSELQRGTLTAESQREQSGAGLRSLGADERLRLAELNAQYRARFGFPFVLAARFSDRTAVPRELARRLL     71 - 140
CPSAQELRTALGEVKKIGSLRLADLLRADPAKL                                         141 - 173
//

Text Mined References (3)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
16462750 2006 Completing the uric acid degradation pathway through phylogenetic comparison of whole genomes.
15057823 2004 The DNA sequence and analysis of human chromosome 13.