Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Gene RIF (1)

AA Sequence

MSHQEGSTGGLPDLVTESLFSSPEEQSGVAAVTAASSDIEMAATEPSTGDGGDTRDGGFLNDASTENQNT      1 - 70
DSESSSEDVELESMGEGLFGYPLVGEETEREEEEEEMEEEGEEEEQPRMCPRCGGTNHDQCLLDEDQALE     71 - 140
EWISSETSALPRSRWQVLTALRQRQLGSSARFVYEACGARTFVQRFRLQYLLGSHAGSVSTIHFNQRGTR    141 - 210
LASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGDSTLAMCGHDGQVRVAELINASYCENTK    211 - 280
RVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRPASKVVVTRENDKKVGLYTISMNPANIYQF    281 - 350
AVGGHDQFVRIYDQRRIDKKENNGVLKKFTPHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSS    351 - 420
LSDGAQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDRGDIVNCLEPH    421 - 490
PYLPVLATSGLDQHVRIWTPTAKTATELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFFVRHLLQRAH    491 - 560
QPGWRDHGAEFPDEEELDESSSTSDTSEEEGQDRVQCIPS                                  561 - 600
//

Text Mined References (4)

PMID Year Title