Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Carcinoma 2,147 1.0

Synonym

Accession A6NGE4 B3KXX1
Symbols WDR42B

Gene

PANTHER Protein Class (2)

 Compartment GO Term (0)

Gene RIF (1)

PMID Text
16949367 Functionally characterizes other DDB1- and CUL4-associated factors, including the DCAF8 factor which most closely resembles the product of this gene.

AA Sequence

MSHQEGSTGGLPDLVTESLFSSPEEQSGVAAVTAASSDIEMAATEPSTGDGGDTRDGGFLNDASTENQNT      1 - 70
DSESSSEDVELESMGEGLFGYPLVGEETEREEEEEEMEEEGEEEEQPRMCPRCGGTNHDQCLLDEDQALE     71 - 140
EWISSETSALPRSRWQVLTALRQRQLGSSARFVYEACGARTFVQRFRLQYLLGSHAGSVSTIHFNQRGTR    141 - 210
LASSGDDLRVIVWDWVRQKPVLNFESGHDINVIQAKFFPNCGDSTLAMCGHDGQVRVAELINASYCENTK    211 - 280
RVAKHRGPAHELALEPDSPYKFLTSGEDAVVFTIDLRQDRPASKVVVTRENDKKVGLYTISMNPANIYQF    281 - 350
AVGGHDQFVRIYDQRRIDKKENNGVLKKFTPHHLVYCDFPTNITCVVYSHDGTELLASYNDEDIYLFNSS    351 - 420
LSDGAQYVKRYKGHRNNDTIKCVNFYGPRSEFVVSGSDCGHVFFWEKSSSQIIQFMEGDRGDIVNCLEPH    421 - 490
PYLPVLATSGLDQHVRIWTPTAKTATELTGLKDVIKKNKQERDEDNLNYTDSFDNRMLRFFVRHLLQRAH    491 - 560
QPGWRDHGAEFPDEEELDESSSTSDTSEEEGQDRVQCIPS                                  561 - 600
//

Text Mined References (4)

PMID Year Title
20932654 2010 Genome-wide association study to identify single nucleotide polymorphisms (SNPs) associated with the development of erectile dysfunction in African-American men after radiotherapy for prostate cancer.
16949367 2006 A family of diverse Cul4-Ddb1-interacting proteins includes Cdt2, which is required for S phase destruction of the replication factor Cdt1.
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.