Property Summary

NCBI Gene PubMed Count 7
PubMed Score 19.39
PubTator Score 8.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 1.28950063504521E-17
ovarian cancer 8492 2.82011560142801E-11
pilocytic astrocytoma 3086 8.82639830220939E-9
sonic hedgehog group medulloblastoma 1482 3.13880522473755E-7
pediatric high grade glioma 2712 1.16397206025551E-4
glioblastoma 5572 1.65005137782614E-4
medulloblastoma, large-cell 6234 2.72974594170241E-4
atypical teratoid / rhabdoid tumor 4369 3.01350390640372E-4
ependymoma 2514 0.00109332668134143
gastric carcinoma 832 0.00513533490699624
oligodendroglioma 2849 0.00526451585303678
astrocytic glioma 2241 0.00536990798436703
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0161679638557311
primitive neuroectodermal tumor 3031 0.0410965855217563
Disease Target Count Z-score Confidence
Parkinson's disease 364 0.0 2.0
Disease Target Count Z-score Confidence
Wiskott-Aldrich syndrome 27 3.347 1.7

Expression

  Differential Expression (14)

Synonym

Accession A6NGB9 B8ZZV2
Symbols CR16

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (2)

PMID Text
21348202 The expressions of the CR16 protein and mRNA decrease markedly in the testis of patients with idiopathic azoospermia.
17573773 CR16 and N-WASP are suggested to play important roles in spermatogenesis

AA Sequence

MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLRKVTQINDRSA      1 - 70
PQIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTI     71 - 140
SGPLIPPASPRLGNTSEAHGAARTAPPRPNVPAPPPPTPPPPPPPLPPPLPSSSPIKTPLVSPPGPLTKG    141 - 210
NLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPA    211 - 280
SPAQDAQEPPAPPPPLPPYASCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPA    281 - 350
PPGSQPFLQKKRHGRPGAGGGKLNPPPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFE    351 - 420
SKFTFHSVEDFPPPDEYKPCQKIYPSKIPRSRTPGPWLQAEAVGQSSDDIKGRNSQLSLKTLR           421 - 483
//

Text Mined References (9)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
21348202 2010 [Expression of CR16 in the testis of patients with idiopathic azoospermia].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17573773 2007 Male-specific sterility caused by the loss of CR16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12372256 2002 The WH1 and EVH1 domains of WASP and Ena/VASP family members bind distinct sequence motifs.