Property Summary

NCBI Gene PubMed Count 7
PubMed Score 19.39
PubTator Score 8.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Synonym

Accession A6NGB9 B8ZZV2
Symbols CR16

Gene

Gene RIF (2)

PMID Text
21348202 The expressions of the CR16 protein and mRNA decrease markedly in the testis of patients with idiopathic azoospermia.
17573773 CR16 and N-WASP are suggested to play important roles in spermatogenesis

AA Sequence

MPVPPPPPPPLPPPPPPLGAPPPPPPSAPPVSTDTSSLRRADPKGRSALLADIQQGTRLRKVTQINDRSA      1 - 70
PQIESSKGTNKEGGGSANTRGASTPPTLGDLFAGGFPVLRPAGQRDVAGGKTGQGPGSRAPSPRLPNKTI     71 - 140
SGPLIPPASPRLGNTSEAHGAARTAPPRPNVPAPPPPTPPPPPPPLPPPLPSSSPIKTPLVSPPGPLTKG    141 - 210
NLPVVAPPVPCAPPPPPPPPPPTPPPLPPASVLSDKAVKPQLAPLHLPPIPPPLPLLPPCGYPGLKAEPA    211 - 280
SPAQDAQEPPAPPPPLPPYASCSPRASLPAPPLPGVNSSSETPPPLPPKSPSFQAPPQKAGAQALPAPPA    281 - 350
PPGSQPFLQKKRHGRPGAGGGKLNPPPAPPARSPTTELSSKSQQATAWTPTQQPGGQLRNGSLHIIDDFE    351 - 420
SKFTFHSVEDFPPPDEYKPCQKIYPSKIPRSRTPGPWLQAEAVGQSSDDIKGRNSQLSLKTLR           421 - 483
//

Text Mined References (9)

PMID Year Title
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22969067 2012 Genetic variants near PDGFRA are associated with corneal curvature in Australians.
21348202 2010 [Expression of CR16 in the testis of patients with idiopathic azoospermia].
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17573773 2007 Male-specific sterility caused by the loss of CR16.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12853948 2003 The DNA sequence of human chromosome 7.
12372256 2002 The WH1 and EVH1 domains of WASP and Ena/VASP family members bind distinct sequence motifs.