Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NGB0
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

 Compartment GO Term (0)

AA Sequence

MCRATLGLPLPPIVIQPARRSLPPIVTPASRRLGPRGGRHLGSVSTAMAATQELLLQLQKDNRDGRQRKQ      1 - 70
ELEKLMRGLEAESESLNQRLQDLSERERSLLRRRSQAAQPLQGEAREAARERAERVRRRLEEAERHKEYL     71 - 140
EQHSRQLQEQWEELSSQLFYYGGELQSQKSTEQQLAAQLVTLQNELELAETKCALQEEKLQQDALQTAEA    141 - 210
WAIFQEQTVVLQVRPHSDAKVPPASPPPDLGRCDGQLRGVQYSTESLMEEMARADRETRLFGGPRALAIR    211 - 280
RCVLGALQVLLTLPLLFLGLSLLWTVLLDPGAVSAWLWSLTSETTLRRLRYTLSPLLELRANGLLPT       281 - 347
//

Text Mined References (3)

PMID Year Title