Property Summary

NCBI Gene PubMed Count 6
Grant Count 3
R01 Count 3
Funding $221,274.99
PubMed Score 0.76

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
26371870 The authors show here that the luminal domain of GnT1IP-L contains its MGAT1 inhibitory activity.

AA Sequence

MRTKQVNLLITLVAVALFSFSCFSIYRITQTNNQLINCRNHILEFKENMLHLRNKTEKNTQEMMKVLNRM      1 - 70
KYEITKREILSGNLVAQKADILNKNETVSNTFEDLKFFFPHLRKEGRIYPDVIIGKGKTGVSFALGISTV     71 - 140
NRGNYSYLKQTLTSVVSRMTLSQEKDSVVIVLVADSNEDYLHSVVKMITKKFKRQVRSGSLEVISIPAFL    141 - 210
YSSMLNAKHLAEASQKLASWRIKQVLDFCILLLYAQPKAKYYLQLEDDIIAKEMYFTKITDFVGNISSNN    211 - 280
WFFIEFSMLGFIGKLFRSEDLTHFVRFFLMFYKEKPIDWLLNDIFQVKVCDAGEDLRNCMKRKKQIRIQY    281 - 350
KPSLFQHVGIHSSFPRKEQYEKKI                                                  351 - 374
//

Text Mined References (6)

PMID Year Title
26371870 2015 GnT1IP-L specifically inhibits MGAT1 in the Golgi via its luminal domain.
20805325 2010 A testis-specific regulator of complex and hybrid N-glycan synthesis.
17903293 2007 Genome-wide association with select biomarker traits in the Framingham Heart Study.
16773575 2006 ELMOD2 is a candidate gene for familial idiopathic pulmonary fibrosis.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.