Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
diabetes mellitus 1728 1.0e-03

AA Sequence

MAKMFDLRTKIMIGIGSSLLVAAMVLLSVVFCLYFKVAKALKAAKDPDAVAVKNHNPDKVCWATNSQAKA      1 - 70
TTMESCPSLQCCEGCRMHASSDSLPPCCCDINEGL                                        71 - 105
//

Text Mined References (1)

PMID Year Title