Property Summary

NCBI Gene PubMed Count 0
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
diabetes mellitus 1,663

AA Sequence

MAKMFDLRTKIMIGIGSSLLVAAMVLLSVVFCLYFKVAKALKAAKDPDAVAVKNHNPDKVCWATNSQAKA      1 - 70
TTMESCPSLQCCEGCRMHASSDSLPPCCCDINEGL                                        71 - 105
//

Text Mined References (1)

PMID Year Title
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.