Property Summary

NCBI Gene PubMed Count 9
PubMed Score 4.59
PubTator Score 5.44

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -1.100 3.9e-02
atypical teratoid / rhabdoid tumor -1.300 3.2e-08
ependymoma -1.100 2.2e-07
glioblastoma -1.200 1.7e-05
malignant mesothelioma 1.100 3.7e-06
oligodendroglioma -1.300 2.8e-02
ovarian cancer 1.200 4.9e-05
primitive neuroectodermal tumor -1.100 1.8e-03
psoriasis 1.200 3.8e-04
subependymal giant cell astrocytoma -1.115 1.1e-02

Gene RIF (3)

AA Sequence

MSRHSRLQRQVLSLYRDLLRAGRGKPGAEARVRAEFRQHAGLPRSDVLRIEYLYRRGRRQLQLLRSGHAT      1 - 70
AMGAFVRPRAPTGEPGGVGCQPDDGDSPRNPHDSTGAPETRPDGR                              71 - 115
//

Text Mined References (13)

PMID Year Title