Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.27
PubTator Score 1.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 4.0e-06
Disease Target Count Z-score Confidence
Loeys-Dietz syndrome 23 4.576 2.3
Ehlers-Danlos syndrome 43 3.961 2.0

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.065 4.0e-06

AA Sequence

MGPRQGRWWLLLWLPPLATLPVRGEAAAAALSVRRCKALKEKDLIRTSESDCYCYNQNSQVEWKYIWSTM      1 - 70
QVKITSPGLFRIVYIAERHNCQYPENILSFIKCVIHNFWIPKESNEITIIINPYRETVCFSVEPVKKIFN     71 - 140
YMIHVNRNIMDFKLFLVFVAGVFLFFYARTLSQSPTFYYSSGTVLGVLMTLVFVLLLVKRFIPKYSTFWA    141 - 210
LMVGCWFASVYIVCQLMEDLKWLWYENRIYVLGYVLIVGFFSFVVCYKHGPLADDRSRSLLMWMLRLLSL    211 - 280
VLVYAGVAVPQFAYAAIILLMSSWSLHYPLRACSYMRWKMEQWFTSKELVVKYLTEDEYREQADAETNSA    281 - 350
LEELRRACRKPDFPSWLVVSRLHTPSKFADFVLGGSHLSPEEISLHEEQYGLGGAFLEEQLFNPSTA       351 - 417
//

Text Mined References (5)

PMID Year Title