Property Summary

NCBI Gene PubMed Count 13
PubMed Score 1.19
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 2.9e-74
Disease Target Count Z-score Confidence
Large cell carcinoma 7 3.811 1.9
Lung large cell carcinoma 6 3.772 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 2.9e-74

Gene RIF (2)

AA Sequence

MAAPPAPAAKGSPQPEPHAPEPGPGSAKRGREDSRAGRLSFCTKVCYGIGGVPNQIASSATAFYLQLFLL      1 - 70
DIAQIPAAQVSLVLFGGKVSGAAADPVAGFFINRSQRTGSGRLMPWVLGCTPFIALAYFFLWFLPPFTSL     71 - 140
RGLWYTTFYCLFQALATFFQVPYTALTMLLTPCPRERDSATAYRMTVEMAGTLMGATVHGLIVSGAHRPH    141 - 210
RCEATATPGPVTVSPNAAHLYCIAAAVVVVTYPVCISLLCLGVKERPDPSAPASGPGLSFLAGLSLTTRH    211 - 280
PPYLKLVISFLFISAAVQVEQSYLVLFCTHASQLHDHVQGLVLTVLVSAVLSTPLWEWVLQRFGKKTSAF    281 - 350
GIFAMVPFAILLAAVPTAPVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRHGPGLETIFYSSYVF    351 - 420
FTKLSGACALGISTLSLEFSGYKAGVCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDAS    421 - 490
SRLSLRRRTSYSLA                                                            491 - 504
//

Text Mined References (14)

PMID Year Title