Property Summary

NCBI Gene PubMed Count 12
PubMed Score 0.18
PubTator Score 0.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 2.300 0.000

Gene RIF (1)

PMID Text
18694395 Results identify Mfsd2a (major facilitator superfamily domain-containing protein 2a) and an additional closely related protein Mfsd2b, and suggest that Mfsd2a plays a role in adaptive thermogenesis.

AA Sequence

MAAPPAPAAKGSPQPEPHAPEPGPGSAKRGREDSRAGRLSFCTKVCYGIGGVPNQIASSATAFYLQLFLL      1 - 70
DIAQIPAAQVSLVLFGGKVSGAAADPVAGFFINRSQRTGSGRLMPWVLGCTPFIALAYFFLWFLPPFTSL     71 - 140
RGLWYTTFYCLFQALATFFQVPYTALTMLLTPCPRERDSATAYRMTVEMAGTLMGATVHGLIVSGAHRPH    141 - 210
RCEATATPGPVTVSPNAAHLYCIAAAVVVVTYPVCISLLCLGVKERPDPSAPASGPGLSFLAGLSLTTRH    211 - 280
PPYLKLVISFLFISAAVQVEQSYLVLFCTHASQLHDHVQGLVLTVLVSAVLSTPLWEWVLQRFGKKTSAF    281 - 350
GIFAMVPFAILLAAVPTAPVAYVVAFVSGVSIAVSLLLPWSMLPDVVDDFQLQHRHGPGLETIFYSSYVF    351 - 420
FTKLSGACALGISTLSLEFSGYKAGVCKQAEEVVVTLKVLIGAVPTCMILAGLCILMVGSTPKTPSRDAS    421 - 490
SRLSLRR                                                                   491 - 497
//

Text Mined References (13)

PMID Year Title
27301951 2016 Variations of chromosome 2 gene expressions among patients with lung cancer or non-cancer.
26758938 2016 Understanding transport by the major facilitator superfamily (MFS): structures pave the way.
26098515 2015 Structural Biology of the Major Facilitator Superfamily Transporters.
26019538 2014 Whole genome methylation analyses of schizophrenia patients before and after treatment.
25837849 2015 Active transporters as enzymes: an energetic framework applied to major facilitator superfamily and ABC importer systems.
23403214 2013 Structural advances for the major facilitator superfamily (MFS) transporters.
19197348 2009 Genome-wide association studies in an isolated founder population from the Pacific Island of Kosrae.
18694395 2008 Mfsd2a encodes a novel major facilitator superfamily domain-containing protein highly induced in brown adipose tissue during fasting and adaptive thermogenesis.
18537473 2008 Ins and outs of major facilitator superfamily antiporters.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
More...