Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.100 0.001
medulloblastoma, large-cell -1.200 0.000
adult high grade glioma -1.300 0.000
group 4 medulloblastoma -1.100 0.002
non primary Sjogren syndrome sicca 1.200 0.018
psoriasis -1.600 0.000

AA Sequence

MAVPWEEYFRLALQEKLSTKLPEQAEDHVPPVLRLLEKRQELVDADQALQAQKEVFRTKTAALKQRWEQL      1 - 70
EQKERELKGSFIRFDKFLQDSEARRNRALRRAAEERHQAGRREVEALRLWTQLQELRREHARLQRRLKRL     71 - 140
EPCARLLEQALELLPGFQEVPELVARFDGLAETQAALRLREREQLAELEAARARLQQLRDAWPDEVLAQG    141 - 210
QRRAQLQERLEAARERTLQWESKWIQIQNTAAEKTLLLGRSRMAVLNLFQLVCQHQGQPPTLDIEDTEGQ    211 - 280
LEHVKLFMQDLSAMLAGLGQAEPAAPAS                                              281 - 308
//

Text Mined References (2)

PMID Year Title
23569216 2013 The MIA complex is a conserved and novel dynein regulator essential for normal ciliary motility.
16541075 2006 The finished DNA sequence of human chromosome 12.