Property Summary

NCBI Gene PubMed Count 1
PubMed Score 4.86
PubTator Score 3.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Intracranial hypertension 9 4.309 2.2

Expression

AA Sequence

MPGSEDLRKGKDQMHSHRKRTMFTKKQLEDLNILFNENPYPNPSLQKEMASKIDIHPTVLQVWFKNHRAK      1 - 70
LKKAKCKHIHQKQETPQPPIPEGGVSTSVGLRNADTLPRLPNAAHPIGLVYTGHRVPSFQLILYPNLKVP     71 - 140
ANDFIGHRIVHFGCCRDPNIYCLYPILESQVCAPSFHSGSPACSSNQSRER                       141 - 191
//

Text Mined References (2)

PMID Year Title
17005330 2007 Annotation, nomenclature and evolution of four novel homeobox genes expressed in the human germ line.
15057824 2004 The DNA sequence and biology of human chromosome 19.