Property Summary

NCBI Gene PubMed Count 14
Grant Count 197
R01 Count 89
Funding $28,961,528.02
PubMed Score 1368.43
PubTator Score 253.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Synonym

Accession A6NFN3 B4DEG6 B4DF29
Symbols FOX3
NEUN
FOX-3
HRNBP3

Gene

Gene RIF (9)

PMID Text
25760045 HIV-1 Tat downregulates the expression of RBFOX3/NEUN in human neurons
25524026 RBFOX proteins can facilitate the splicing of micro-exons. We also found that PTBP1 likely regulates the inclusion of micro-exons, possibly by repressing the inclusion of micro-exons that are enhanced by RBFOX proteins and other splicing factors.[RBFOX]
24215932 RNA splicing occurs in the nucleus hence, the altered localization of RbFox3 to the cytoplasm may lead to the downregulation of neuronal gene expression.
24039908 Exome sequencing of 242 rolandic epilepsy patients revealed two novel probably deleterious variants in RBFOX1, a frameshift mutation (p.A233Vfs*74) and a hexanucleotide deletion (p.A299_A300del), and a novel nonsense mutation in RBFOX3 (p.Y287*).
23898728 NeuN immunocytochemical reaction in neurons of human substantia nigra was expressed much weaker than in the nucleus rubrum neurons located in the same sections.
23512105 In addition, eight genes classified as 'second tier' hits in the original study (PAX7, THADA, COL8A1/FILIP1L, DCAF4L2, GADD45G, NTN1, RBFOX3 and FOXE1) showed evidence of linkage and association in this replication sample.
23371454 High NeuN levels are associated with supratentorial ependymomas.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19713214 NeuN (neuronal nuclei) is a neuron-specific nuclear protein identified by anti-NeuN antibody, and widely used as the postmitotic neuron marker. NeuN is identified as the Fox-3 gene product by mass spectrometry, immunoblotting, RNAi, and immunostaining.

AA Sequence

MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGT      1 - 70
QTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGF     71 - 140
GFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTGNPYTNGWKLNPVVGAVYGPEFYAVTG    141 - 210
FPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAA    211 - 280
AAYSDSYGRVYAAADPYHHTIGPAATYSIGTM                                          281 - 312
//

Text Mined References (15)

PMID Year Title
25524026 2015 RBFOX and PTBP1 proteins regulate the alternative splicing of micro-exons in human brain transcripts.
24215932 2014 Altered subcellular localization of the NeuN/Rbfox3 RNA splicing factor in HIV-associated neurocognitive disorders (HAND).
24039908 2013 RBFOX1 and RBFOX3 mutations in rolandic epilepsy.
23898728 2013 [NeuN nuclear protein in neurons of human brain substantia nigra].
23817569 2013 A genome-wide association meta-analysis of self-reported allergy identifies shared and allergy-specific susceptibility loci.
23512105 2013 Confirming genes influencing risk to cleft lip with/without cleft palate in a case-parent trio study.
23371454 2013 Supra- and infratentorial pediatric ependymomas differ significantly in NeuN, p75 and GFAP expression.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19713214 2009 Identification of neuronal nuclei (NeuN) as Fox-3, a new member of the Fox-1 gene family of splicing factors.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
More...