Property Summary

NCBI Gene PubMed Count 18
PubMed Score 1462.92
PubTator Score 253.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -4.300 1.8e-05
astrocytic glioma -2.800 2.0e-03
Astrocytoma, Pilocytic -5.300 7.5e-10
atypical teratoid / rhabdoid tumor -5.400 2.7e-11
diabetes mellitus 1.300 1.0e-03
ependymoma -3.700 5.0e-03
glioblastoma -4.700 1.2e-10
group 3 medulloblastoma -2.300 2.5e-02
medulloblastoma, large-cell -2.600 5.4e-05
oligodendroglioma -1.700 3.8e-02
pituitary cancer -1.700 2.3e-04
primitive neuroectodermal tumor -5.000 4.6e-05
subependymal giant cell astrocytoma -4.751 7.8e-03

Gene RIF (13)

AA Sequence

MAQPYPPAQYPPPPQNGIPAEYAPPPPHPTQDYSGQTPVPTEHGMTLYTPAQTHPEQPGSEASTQPIAGT      1 - 70
QTVPQTDEAAQTDSQPLHPSDPTEKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNERGSKGF     71 - 140
GFVTFETSSDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTGNPYTNGWKLNPVVGAVYGPEFYAVTG    141 - 210
FPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAVVYQDGFYGAEIYGGYAAYRYAQPAAAA    211 - 280
AAYSDSYGRVYAAADPYHHTIGPAATYSIGTM                                          281 - 312
//

Text Mined References (19)

PMID Year Title