Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Deafness, Autosomal Recessive 101 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 2.7e-20
Disease Target Count Z-score Confidence
Nonsyndromic deafness 142 3.492 1.7

Gene RIF (1)

AA Sequence

MEDPEKKLNQKSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEV      1 - 70
PRPQMCSPKLTAQRISVFREGNAYTLAGGQPRFNDYKANDHKPLPIIDFGKIIIYTNNLKIIRTPMDKRD     71 - 140
FVRKILQKEEEAEEESLMNKEESYGGRDQHDRPLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSL    141 - 210
CHGSKFSMLANRFKESYRALRCPACNENGLQPCQICNQ                                    211 - 248
//

Text Mined References (2)

PMID Year Title