Property Summary

NCBI Gene PubMed Count 2
Grant Count 5
R01 Count 5
Funding $486,519.67
PubMed Score 1.00
PubTator Score 1.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
Nonsyndromic deafness 121 4.0
psoriasis 6,683

Gene RIF (1)

PMID Text
24619944 ur results indicate that GRXCR2 should be considered in differential genetic diagnosis for individuals with early onset, moderate-to-severe and progressive hearing loss.

AA Sequence

MEDPEKKLNQKSDGKPRKVRFKISSSYSGRVLKQVFEDGQELESPKEEYPHSFLQESLETMDGVYGSGEV      1 - 70
PRPQMCSPKLTAQRISVFREGNAYTLAGGQPRFNDYKANDHKPLPIIDFGKIIIYTNNLKIIRTPMDKRD     71 - 140
FVRKILQKEEEAEEESLMNKEESYGGRDQHDRPLVEAESTLPQNRYTQEGDIPEDSCFHCRGSGSATCSL    141 - 210
CHGSKFSMLANRFKESYRALRCPACNENGLQPCQICNQ                                    211 - 248
//

Publication (2)

PMID Year Title
24619944 2014 A frameshift mutation in GRXCR2 causes recessively inherited hearing loss.
15372022 2004 The DNA sequence and comparative analysis of human chromosome 5.