Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.60
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 0.000

Gene RIF (1)

PMID Text
18786628 FABP12 arose as the result of tandem gene duplication, a mechanism that may have been instrumental to the expansion of the FABP family.

AA Sequence

MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEE      1 - 70
FEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS     71 - 140
//

Text Mined References (6)

PMID Year Title
23535730 2013 GWAS meta-analysis and replication identifies three new susceptibility loci for ovarian cancer.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
18786628 2008 A novel fatty acid-binding protein (FABP) gene resulting from tandem gene duplication in mammals: transcription in rat retina and testis.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.