Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.60
PubTator Score 1.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 3.7e-04
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 1.9
lung cancer 4740 0.0 1.2

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 3.7e-04

Gene RIF (1)

AA Sequence

MIDQLQGTWKSISCENSEDYMKELGIGRASRKLGRLAKPTVTISTDGDVITIKTKSIFKNNEISFKLGEE      1 - 70
FEEITPGGHKTKSKVTLDKESLIQVQDWDGKETTITRKLVDGKMVVESTVNSVICTRTYEKVSSNSVSNS     71 - 140
//

Text Mined References (6)

PMID Year Title