Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14

Knowledge Summary

Patent

No data available

AA Sequence

MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLR      1 - 70
EFHSVERKFATIYGPLLEKRRQITNALYEPTKEECER                                      71 - 107
//

Text Mined References (2)

PMID Year Title