Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.14

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession A6NFF2
Symbols

Gene

 GO Component (1)

 GO Process (1)

 Compartment GO Term (1)

AA Sequence

MMEGLGEHSTAGEMGPLLGAVAATASPQSLMEYSSDADFIESLPLVVKYRVYTLKKLQAKCAVLEAKYLR      1 - 70
EFHSVERKFATIYGPLLEKRRQITNALYEPTKEECER                                      71 - 107
//

Text Mined References (2)

PMID Year Title
15772651 2005 The DNA sequence of the human X chromosome.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.