Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
lung adenocarcinoma 2716 1.2e-05

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 1.2e-05

AA Sequence

METSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVA      1 - 70
MFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEI                  71 - 127
//

Text Mined References (5)

PMID Year Title