Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 1.18454263943511E-5

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Synonym

Accession A6NFE3
Symbols

Gene

  Ortholog (7)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Opossum OMA EggNOG
Platypus OMA EggNOG
Anole lizard OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

METSSRELQAAEYLEKHQIKEVVSYLTSALLFFRPEKPKEYLISLLERLRIAKVTGVAFPFFMDNSNIVA      1 - 70
MFEMMDSSGRGTISFVQYKEALKTLGLCTEDEDLQDDGHKITLDKFKEEVNKRMKEI                  71 - 127
//

Text Mined References (5)

PMID Year Title
24322204 2014 Genome-wide association study of bipolar disorder accounting for effect of body mass index identifies a new risk allele in TCF7L2.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.