Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.04

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 2.06237071692741E-11
oligodendroglioma 2849 2.08373039267891E-8
atypical teratoid/rhabdoid tumor 1095 3.62397353873041E-5
Pick disease 1893 1.53504638949546E-4
pediatric high grade glioma 2712 2.08641881413732E-4
group 3 medulloblastoma 2254 0.00542357188538391
subependymal giant cell astrocytoma 2287 0.00860974544049175
pilocytic astrocytoma 3086 0.0137968052682281
progressive supranuclear palsy 674 0.0170001590975739
ependymoma 2514 0.0177170880443881
primitive neuroectodermal tumor 3031 0.0199898302417468
astrocytic glioma 2241 0.0206521582980566

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.100 0.021
ependymoma -2.500 0.018
glioblastoma multiforme -1.900 0.000
oligodendroglioma -1.800 0.000
group 3 medulloblastoma -2.500 0.005
atypical teratoid/rhabdoid tumor -1.900 0.000
primitive neuroectodermal tumor -1.600 0.020
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.400 0.014
subependymal giant cell astrocytoma -2.584 0.009
Pick disease -2.000 0.000
progressive supranuclear palsy -2.000 0.017

Synonym

Accession A6NFC5 C9JRE6
Symbols ARGM1

Gene

  Ortholog (5)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG

Gene RIF (1)

PMID Text
21689651 Data demonstrate that TMEM114, and the closely related TMEM235, are closely related to members of the voltage dependent calcium channel gamma subunit family.

AA Sequence

MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWRICEGQNGCIP      1 - 70
LVDPFASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLAQSVSLLLFTGCYFLLGSVLT     71 - 140
LAGVSIYISYSHLAFAETVQQYGPQHMQGVRVSFGWSMALAWGSCALEAFSGTLLLSAAWTLSLSPPICG    141 - 210
HLSPQQVGGRGGD                                                             211 - 223
//

Text Mined References (4)

PMID Year Title
21689651 2011 The cataract-associated protein TMEM114, and TMEM235, are glycosylated transmembrane proteins that are distinct from claudin family members.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.