Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.100 2.1e-02
Astrocytoma, Pilocytic -1.300 1.4e-02
atypical teratoid / rhabdoid tumor -1.200 5.5e-03
ependymoma -2.500 1.8e-02
glioblastoma -1.300 4.6e-03
group 3 medulloblastoma -2.500 5.4e-03
oligodendroglioma -1.800 2.1e-08
pediatric high grade glioma -1.800 2.1e-04
Pick disease -2.000 1.5e-04
primitive neuroectodermal tumor -1.600 2.0e-02
progressive supranuclear palsy -2.000 1.7e-02
subependymal giant cell astrocytoma -2.584 8.6e-03

Gene RIF (1)

AA Sequence

MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWRICEGQNGCIP      1 - 70
LVDPFASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLAQSVSLLLFTGCYFLLGSVLT     71 - 140
LAGVSIYISYSHLAFAETVQQYGPQHMQGVRVSFGWSMALAWGSCALEAFSGTLLLSAAWTLSLSPPICG    141 - 210
HLSPQQVGGRGGD                                                             211 - 223
//

Text Mined References (4)

PMID Year Title