Property Summary

NCBI Gene PubMed Count 2
PubMed Score 1.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -2.100 0.021
ependymoma -2.500 0.018
glioblastoma multiforme -1.900 0.000
oligodendroglioma -1.800 0.000
group 3 medulloblastoma -2.500 0.005
atypical teratoid/rhabdoid tumor -1.900 0.000
primitive neuroectodermal tumor -1.600 0.020
pediatric high grade glioma -1.800 0.000
pilocytic astrocytoma -1.400 0.014
subependymal giant cell astrocytoma -2.584 0.009
Pick disease -2.000 0.000
progressive supranuclear palsy -2.000 0.017

Gene RIF (1)

PMID Text
21689651 Data demonstrate that TMEM114, and the closely related TMEM235, are closely related to members of the voltage dependent calcium channel gamma subunit family.

AA Sequence

MARLGALLLAAALGALLSFALLAAAVASDYWYILEVADAGNGSAWPGRAELLSSHSGLWRICEGQNGCIP      1 - 70
LVDPFASESLDVSTSVQHLILLHRAVIVVLPLSLVLLVCGWICGLLSSLAQSVSLLLFTGCYFLLGSVLT     71 - 140
LAGVSIYISYSHLAFAETVQQYGPQHMQGVRVSFGWSMALAWGSCALEAFSGTLLLSAAWTLSLSPPICG    141 - 210
HLSPQQVGGRGGD                                                             211 - 223
//

Text Mined References (4)

PMID Year Title
21689651 2011 The cataract-associated protein TMEM114, and TMEM235, are glycosylated transmembrane proteins that are distinct from claudin family members.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.