Property Summary

NCBI Gene PubMed Count 10
PubMed Score 7.28
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
osteosarcoma 7950 1.1e-05

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.441 1.1e-05

Gene RIF (4)

AA Sequence

MHAALAGPLLAALLATARARPQPPDGGQCRPPGSQRDLNSFLWTIRRDPPAYLFGTIHVPYTRVWDFIPD      1 - 70
NSKAAFQASTRVYFELDLTDPYTISALASCQLLPHGENLQDVLPHELYWRLKRHLDYVKLMMPSWMTPAQ     71 - 140
RGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTERDVRFRGVPVLDLYLAQQAEKMKKTTGAVEQVEEQ    141 - 210
CHPLNNGLNFSQVLFALNQTLLQQESVRAGSLQASYTTEDLIKHYNCGDLSAVIFNHDTSQLPNFINTTL    211 - 280
PPHEQVTAQEIDSYFRQELIYKRNERMGKRVMALLRENEDKICFFAFGAGHFLGNNTVIDILRQAGLEVD    281 - 350
HTPAGQAIHSPAPQSPAPSPEGTSTSPAPVTPAAAVPEAPSVTPTAPPEDEDPALSPHLLLPDSLSQLEE    351 - 420
FGRQRKWHKRQSTHQRPRQFNDLWVRIEDSTTASPPPLPLQPTHSSGTAKPPFQLSDQLQQQDPPGPASS    421 - 490
SAPTLGLLPAIATTIAVCFLLHSLGPS                                               491 - 517
//

Text Mined References (10)

PMID Year Title