Property Summary

NCBI Gene PubMed Count 9
Grant Count 5
R01 Count 5
Funding $559,806.8
PubMed Score 3.62
PubTator Score 4.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
osteosarcoma 7,933

Expression

  Differential Expression (1)

Disease log2 FC p
osteosarcoma -2.441 0.000

Gene RIF (3)

PMID Text
26631728 examination of the structural prediction and identification of the active site residues of human TIKI2
24771064 provided evidence that reduced expression of TIKI family protein in osteosarcoma may participate in the progression of osteosarcoma and restoring its expression was able to impair the growth of osteosarcoma
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)

AA Sequence

MHAALAGPLLAALLATARARPQPPDGGQCRPPGSQRDLNSFLWTIRRDPPAYLFGTIHVPYTRVWDFIPD      1 - 70
NSKAAFQASTRVYFELDLTDPYTISALASCQLLPHGENLQDVLPHELYWRLKRHLDYVKLMMPSWMTPAQ     71 - 140
RGKGLYADYLFNAIAGNWERKRPVWVMLMVNSLTERDVRFRGVPVLDLYLAQQAEKMKKTTGAVEQVEEQ    141 - 210
CHPLNNGLNFSQVLFALNQTLLQQESVRAGSLQASYTTEDLIKHYNCGDLSAVIFNHDTSQLPNFINTTL    211 - 280
PPHEQVTAQEIDSYFRQELIYKRNERMGKRVMALLRENEDKICFFAFGAGHFLGNNTVIDILRQAGLEVD    281 - 350
HTPAGQAIHSPAPQSPAPSPEGTSTSPAPVTPAAAVPEAPSVTPTAPPEDEDPALSPHLLLPDSLSQLEE    351 - 420
FGRQRKWHKRQSTHQRPRQFNDLWVRIEDSTTASPPPLPLQPTHSSGTAKPPFQLSDQLQQQDPPGPASS    421 - 490
SAPTLGLLPAIATTIAVCFLLHSLGPS                                               491 - 517
//

Text Mined References (9)

PMID Year Title
26631728 2016 Characterization of Tiki, a New Family of Wnt-specific Metalloproteases.
25354456 2014 Expression and evolution of the Tiki1 and Tiki2 genes in vertebrates.
24771064 2014 TIKI2 suppresses growth of osteosarcoma by targeting Wnt/?-catenin pathway.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22726442 2012 Tiki1 is required for head formation via Wnt cleavage-oxidation and inactivation.
22425255 2012 A genome-wide search for genetic influences and biological pathways related to the brain's white matter integrity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.