Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
medulloblastoma, large-cell 6,234

Expression

  Differential Expression (1)

Disease log2 FC p
medulloblastoma, large-cell 1.200 0.000

AA Sequence

MLSPTFVLWDVGYPLYTYGSICIIALIIWQVKKSCQKLSLVPNRSCCRCHRRVQQKSGDRTSRARRTSQE      1 - 70
EAEKLWKLLFLMKSQGWLPQEGSVRRILCADPCCQICNVMALEIKQLLAGENNQISLTSLGPSQGSSCLE     71 - 140
ALSTSSVSFKHSQDLGSPKSKELSLASVTPTLSQLMDQKSLTQSAARSAGADSVQDSWADHFQRGQRSQV    141 - 210
PAVSQVMGSLSSNFEKPGIPLSQQERTKNNSKFVLENQEAPEVGLDNKMKLFLHWINPEMKDRRHEESIL    211 - 280
LSKAETVTQDRTKNIEKSPTVTKDHVWGATTQKTTEDPEAQPPSTEEEGLIFCDAPSA                281 - 338
//

Text Mined References (1)

PMID Year Title
15164053 2004 DNA sequence and analysis of human chromosome 9.