Property Summary

NCBI Gene PubMed Count 1
PubMed Score 15.03
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
psoriasis 6694 7.4e-13
fibroadenoma 559 7.8e-03
Disease Target Count Z-score Confidence
Burkitt Lymphoma 20 3.625 1.8

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.100 7.8e-03
psoriasis -1.200 7.4e-13

Synonym

Accession A6NF83
Symbols NUPR1L

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG

Gene RIF (1)

AA Sequence

MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHER      1 - 70
KVAQKLLNGQRKRRQRQLHPKMRTRLT                                                71 - 97
//

Text Mined References (3)

PMID Year Title