Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.58
PubTator Score 0.67

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Disease Z-score Confidence
fibroadenoma 557
psoriasis 6,685

Expression

  Differential Expression (2)

Disease log2 FC p
fibroadenoma 1.100 0.008
psoriasis -1.200 0.000

Gene RIF (1)

PMID Text
25899918 Functional characterization of NUPR1L as a new p53-induced gene, which negatively regulates the protumoral factor NUPR1.

AA Sequence

MEAPAERALPRLQALARPPPPISYEEELYDCLDYYYLRDFPACGAGRSKGRTRREQALRTNWPAPGGHER      1 - 70
KVAQKLLNGQRKRRQRQLHPKMRTRLT                                                71 - 97
//

Text Mined References (3)

PMID Year Title
25899918 2015 Functional Characterization of Nupr1L, A Novel p53-Regulated Isoform of the High-Mobility Group (HMG)-Related Protumoral Protein Nupr1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12853948 2003 The DNA sequence of human chromosome 7.