Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.17

Knowledge Summary

Patent

No data available

AA Sequence

MGSHESLGPYFLVFLLLLLLPPPLFRAGSLRYHGPDWRIFHRLALGSRRAHHHHGPGWRQHWRQGQAGHR      1 - 70
CQGSFDLYFILDKSGSVNNNWIDLYMWVEETVARFQSPNIRMCFITYSTDGQTVLPLTSDKNRIKNGLDQ     71 - 140
LQKIVPDGHTFMQAGFRKAIQQIESFNSGNKVPSMIIAMTDGELVAHAFQDTLREAQKARKLGANVYTLG    141 - 210
VADYNLDQITAIADSPGHVFAVENGFKALRSTIDALTSKVCLDVTSVEPSSECVGEPYHVVIHGNGFQNL    211 - 280
KKRDEVICRFIFNESTIIDEKPTSIDNNSMNCPGPKLEKPGEEYSIEVSLNKGKTFFKSNVSITSTTCGI    281 - 350
FRNWLYFVPLLLLVPLLLCCVWRLCRKQTVKEPPPVQKPEKEPEQEKPPSPPPPPPPPPPPLPPPPPAPV    351 - 420
NTCPTVIICCCGCQGVGGMRRIEGNLDTFCDLSHASCHQVPWMCCQSRDQGRYLSLALAQSQYAQAPCCP    421 - 490
RICFPHSQECLSLPQAPCSPRMCLRHSRECLALKQARCSPNICLRHSQHSRECLARKQAPCSPRICLRHS    491 - 560
PEYFSQAQTLCNPKSCLQPSRECLPLTCSSRCRLPPARCLRPPSRMLPLLSPLLRHTAEPPLSLPPSEPN    561 - 630
F//

Publication (3)

PMID Year Title
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15164054 2004 The DNA sequence and comparative analysis of human chromosome 10.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.