Property Summary

NCBI Gene PubMed Count 4
PubMed Score 0.00

Knowledge Summary

Patent

No data available

Synonym

Accession A6NF01
Symbols

Gene

 GO Component (1)

AA Sequence

MSRRVRTSELWKRNGPSSSPFSSPASSRSQTPERPAKKIREEEMCHHSSSSTPLAADKESQGEKAADTTP      1 - 70
RKKQNSNSQSTPGSSGQRKRKVQLLPSRRGEQLTLPPPPQLGYSITAEDLDLEKKASLQWFNQALEDKSD     71 - 140
AASNSVTETPPITQPSFTFTLPAAAPASPPTSLLAPSTNPLLESLKKMQTPPSLPPCPESAGAATTEALS    141 - 210
PPKTPNLLPPLGLSQSGPPGLLPSPSFDSNPPTTLLGLIPAPSMVPATDTKAPPTLQAETTTKPQATSAP    211 - 280
SPAPKQSFLFGTQNTSPSSPAAPAASSASPMFKPIFTAPPKSEKEGPTPPGPSVSATAPSSSSLPTTTST    281 - 350
TAPTFQPVFSSMGPPASVPLPAPFFKQTTTPATAPTTTAPLFTGLASATSAVAPITSASPSTDSASKPAF    351 - 420
GFGINSVSSSSVSTTTSTATAASQPFLFGAPQASAASFTPAMGSIFQFGKPPALPTTTTVTTFSQSLPTA    421 - 490
VPTATSSSAADFSGFGSTLATSAPATSSQPTLTFSNTSTPTFNIPFGSSAKSPLPSYPGANPQPAFGAAE    491 - 560
GQPPGAAKPALTPSFGSSFTFGNSAAPAAAPTPAPPSMIKIVPAHVPTPIQPTFGGATHSAFGLKATASA    561 - 630
FGAPASSQPAFGGSTAVFSFGAATSSGFGATTQTASSGSSSSVFGSTTPSPFTFGGSAAPAGSGSFGINV    631 - 700
ATPGSSATTGAFSFGAGQSGSTATSTPFAGGLGQNALGTTGQSTPFAFNVGSTTESKPVFGGTATPTFGL    701 - 770
NTPAPGVGTSGSSLSFGASSAPAQGFVGVAPFGSAAPSFSIGAGSKTLGARQRLQARRQHTRKK          771 - 834
//

Text Mined References (4)

PMID Year Title
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
17900573 2007 Two distinct human POM121 genes: requirement for the formation of nuclear pore complexes.
12853948 2003 The DNA sequence of human chromosome 7.
9847074 1998 Toward a complete human genome sequence.